SCOPe 2.07: Domain d2zzaa_: 2zza A:

Lineage for d2zzaa_ (2zza A:)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.71: Dihydrofolate reductase-like [53596] (1 superfamily)
   3 layers: a/b/a; mixed beta-sheet of 8 strands, order 34251687; strand 8 is antiparallel to the rest

4. Superfamily c.71.1: Dihydrofolate reductase-like [53597] (3 families)

5. Family c.71.1.0: automated matches [191485] (1 protein)
   not a true family

6. Protein automated matches [190777] (27 species)
   not a true protein

7. Species Moritella profunda [TaxId:111291] [189013] (3 PDB entries)

8. Domain d2zzaa_: 2zza A: [171612]
   automated match to d1dhja_
   complexed with 1pe, fol, nap

Details for d2zzaa_

PDB Entry: 2zza, 2 Å

PDB Description: Moritella profunda Dihydrofolate reductase complex with NADP+ and Folate

PDB Compounds: (A:) dihydrofolate reductase

SCOPe Domain Sequences for d2zzaa_:

Sequence; same for both SEQRES and ATOM records:

>d2zzaa_ c.71.1.0 (A:) automated matches {Moritella profunda [TaxId: 111291]}
vivsmiaalannrvigldnkmpwhlpaelqlfkratlgkpivmgrntfesigrplpgrln
ivlsrqtdyqpegvtvvatledavvaagdveelmiiggatiynqclaaadrlylthielt
tegdtwfpdyeqynwqeiehesyaaddknphnyrfsllerv

Timeline for d2zzaa_:

• d2zzaa_ first appeared in SCOPe 2.01
  
• d2zzaa_ appears in SCOPe 2.06
  
• d2zzaa_ appears in the current release, SCOPe 2.08