![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.71: Dihydrofolate reductase-like [53596] (1 superfamily) 3 layers: a/b/a; mixed beta-sheet of 8 strands, order 34251687; strand 8 is antiparallel to the rest |
![]() | Superfamily c.71.1: Dihydrofolate reductase-like [53597] (3 families) ![]() |
![]() | Family c.71.1.0: automated matches [191485] (1 protein) not a true family |
![]() | Protein automated matches [190777] (28 species) not a true protein |
![]() | Species Moritella profunda [TaxId:111291] [189013] (3 PDB entries) |
![]() | Domain d2zzaa_: 2zza A: [171612] automated match to d1dhja_ complexed with 1pe, fol, nap |
PDB Entry: 2zza (more details), 2 Å
SCOPe Domain Sequences for d2zzaa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2zzaa_ c.71.1.0 (A:) automated matches {Moritella profunda [TaxId: 111291]} vivsmiaalannrvigldnkmpwhlpaelqlfkratlgkpivmgrntfesigrplpgrln ivlsrqtdyqpegvtvvatledavvaagdveelmiiggatiynqclaaadrlylthielt tegdtwfpdyeqynwqeiehesyaaddknphnyrfsllerv
Timeline for d2zzaa_: