SCOPe 2.05: Domain d2zywx_: 2zyw X:

Lineage for d2zywx_ (2zyw X:)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (25 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.5: PAPS sulfotransferase [52575] (15 proteins)
   Pfam PF00685
   similar to the nucleotide/nucleoside kinases but transfer sulphate group

6. Protein automated matches [190189] (4 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [188670] (8 PDB entries)

8. Domain d2zywx_: 2zyw X: [171611]
   automated match to d1ls6a_
   complexed with a3p, gol, npo

Details for d2zywx_

PDB Entry: 2zyw, 1.8 Å

PDB Description: crystal structure of mouse cytosolic sulfotransferase mSULT1D1 complex with PAP and p-nitrophenol, obtained by two-step soaking method

PDB Compounds: (X:) Tyrosine-ester sulfotransferase

SCOPe Domain Sequences for d2zywx_:

Sequence; same for both SEQRES and ATOM records:

>d2zywx_ c.37.1.5 (X:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
dvfrrelvdvegiplfwsiaehwsqvesfearpddilistypksgttwvseildliynng
daekckrdaiykrvpfmeliipgitngvemlnnmpsprivkthlpvqllpssfwkndcki
iyvarnakdvvvsyyyfyqmakihpepgtweeflekfmagqvsfgpwydhvkswwekrke
yrilylfyedmkenpkceiqkilkflekdipeeilnkilyhssfsvmkenpsanyttmmk
eemdhsvspfmrkgisgdwknqftvaqyekfeedyvkkmedstlkfrse

Timeline for d2zywx_:

• d2zywx_ first appeared in SCOPe 2.01
  
• d2zywx_ appears in SCOPe 2.04
  
• d2zywx_ appears in SCOPe 2.06
  
• d2zywx_ appears in the current release, SCOPe 2.08