Lineage for d2zy0a_ (2zy0 A:)

  1. Root: SCOPe 2.02
  2. 1074916Class a: All alpha proteins [46456] (284 folds)
  3. 1097039Fold a.123: Nuclear receptor ligand-binding domain [48507] (1 superfamily)
    multihelical; 3 layers or orthogonally packed helices
  4. 1097040Superfamily a.123.1: Nuclear receptor ligand-binding domain [48508] (2 families) (S)
  5. 1097041Family a.123.1.1: Nuclear receptor ligand-binding domain [48509] (34 proteins)
  6. 1097667Protein Retinoid-X receptor alpha (RXR-alpha) [48510] (2 species)
  7. 1097668Species Human (Homo sapiens) [TaxId:9606] [48511] (33 PDB entries)
    Uniprot P19793 227-458
  8. 1097713Domain d2zy0a_: 2zy0 A: [171603]
    automated match to d1lbda_
    complexed with 21p

Details for d2zy0a_

PDB Entry: 2zy0 (more details), 2.9 Å

PDB Description: crystal structure of the human rxr alpha ligand binding domain bound to a synthetic agonist compound and a coactivator peptide
PDB Compounds: (A:) Retinoic acid receptor RXR-alpha

SCOPe Domain Sequences for d2zy0a_:

Sequence, based on SEQRES records: (download)

>d2zy0a_ a.123.1.1 (A:) Retinoid-X receptor alpha (RXR-alpha) {Human (Homo sapiens) [TaxId: 9606]}
nedmpverileaelavepktetyveanmglnpsspndpvtnicqaadkqlftlvewakri
phfselplddqvillragwnelliasfshrsiavkdgillatglhvhrnsahsagvgaif
drvltelvskmrdmqmdktelgclraivlfnpdskglsnpaevealrekvyasleayckh
kypeqpgrfaklllrlpalrsiglkclehlfffkligdtpidtflmemleap

Sequence, based on observed residues (ATOM records): (download)

>d2zy0a_ a.123.1.1 (A:) Retinoid-X receptor alpha (RXR-alpha) {Human (Homo sapiens) [TaxId: 9606]}
nedmpverileaelavepndpvtnicqaadkqlftlvewakriphfselplddqvillra
gwnelliasfshrsiavkdgillatglhvhrnsahsagvgaifdrvltelvskmrdmqmd
ktelgclraivlfnpdskglsnpaevealrekvyasleayckhkypeqpgrfaklllrlp
alrsiglkclehlfffkligdtpidtflmemleap

SCOPe Domain Coordinates for d2zy0a_:

Click to download the PDB-style file with coordinates for d2zy0a_.
(The format of our PDB-style files is described here.)

Timeline for d2zy0a_: