Lineage for d2zxxf_ (2zxx F:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2305222Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 2306394Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (86 families) (S)
    contains a small beta-sheet (wing)
  5. 2307654Family a.4.5.52: DNA replication factor Cdt1 [109686] (2 proteins)
    automatically mapped to Pfam PF08839
  6. 2307655Protein DNA replication factor Cdt1 [109687] (1 species)
  7. 2307656Species Mouse (Mus musculus) [TaxId:10090] [109688] (1 PDB entry)
    Uniprot Q8R4E9 179-365
  8. 2307658Domain d2zxxf_: 2zxx F: [171601]
    Other proteins in same PDB: d2zxxa_, d2zxxb_, d2zxxd_, d2zxxe_
    protein/DNA complex

Details for d2zxxf_

PDB Entry: 2zxx (more details), 2.8 Å

PDB Description: Crystal structure of Cdt1/geminin complex
PDB Compounds: (F:) DNA replication factor Cdt1

SCOPe Domain Sequences for d2zxxf_:

Sequence, based on SEQRES records: (download)

>d2zxxf_ a.4.5.52 (F:) DNA replication factor Cdt1 {Mouse (Mus musculus) [TaxId: 10090]}
kapayqrfhalaqpglpglvlpykyqvlvemfrsmdtivsmlhnrsetvtfakvkqgvqe
mmrkrfeernvgqiktvyptsyrfrqecnvptfkdsikrsdyqltiepllgqeaggatql
tatcllqrrqvfrqnlvervkeqhkvflaslnppmavpddqltrwhprfnvdevpdiepa
elpqppv

Sequence, based on observed residues (ATOM records): (download)

>d2zxxf_ a.4.5.52 (F:) DNA replication factor Cdt1 {Mouse (Mus musculus) [TaxId: 10090]}
kapayqrfhalaqpglpglvlpykyqvlvemfrsmdtivsmlhnrsetvtfakvkqgvqe
mmrkrfeernvgqiktvyptsyrfrqecnvptfkdsikrsdyqltiepllgqeatqltat
cllqrrqvfrqnlvervkeqhkvflaslnppmavpddqltrwhprfnvdevpdiepaelp
qppv

SCOPe Domain Coordinates for d2zxxf_:

Click to download the PDB-style file with coordinates for d2zxxf_.
(The format of our PDB-style files is described here.)

Timeline for d2zxxf_: