![]() | Class h: Coiled coil proteins [57942] (7 folds) |
![]() | Fold h.1: Parallel coiled-coil [57943] (41 superfamilies) this is not a true fold; includes oligomers of shorter identical helices |
![]() | Superfamily h.1.28: Geminin coiled-coil domain [111469] (2 families) ![]() |
![]() | Family h.1.28.1: Geminin coiled-coil domain [111470] (2 proteins) |
![]() | Protein Geminin coiled-coil domain [111471] (2 species) |
![]() | Species Mouse (Mus musculus) [TaxId:10090] [111473] (1 PDB entry) Uniprot O88513 79-156 |
![]() | Domain d2zxxe_: 2zxx E: [171600] Other proteins in same PDB: d2zxxc_, d2zxxf_ protein/DNA complex |
PDB Entry: 2zxx (more details), 2.8 Å
SCOPe Domain Sequences for d2zxxe_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2zxxe_ h.1.28.1 (E:) Geminin coiled-coil domain {Mouse (Mus musculus) [TaxId: 10090]} tqeafdliskenpssqywkevaeqrrkalyealkeneklhkeieqkdseiarlrkenkdl aevaehvqymaevierls
Timeline for d2zxxe_: