Lineage for d2zxxd_ (2zxx D:)

  1. Root: SCOPe 2.07
  2. 2590057Class h: Coiled coil proteins [57942] (7 folds)
  3. 2590058Fold h.1: Parallel coiled-coil [57943] (41 superfamilies)
    this is not a true fold; includes oligomers of shorter identical helices
  4. 2591334Superfamily h.1.28: Geminin coiled-coil domain [111469] (2 families) (S)
  5. 2591335Family h.1.28.1: Geminin coiled-coil domain [111470] (2 proteins)
  6. 2591336Protein Geminin coiled-coil domain [111471] (2 species)
  7. 2591342Species Mouse (Mus musculus) [TaxId:10090] [111473] (1 PDB entry)
    Uniprot O88513 79-156
  8. 2591345Domain d2zxxd_: 2zxx D: [171599]
    Other proteins in same PDB: d2zxxc_, d2zxxf_
    protein/DNA complex

Details for d2zxxd_

PDB Entry: 2zxx (more details), 2.8 Å

PDB Description: Crystal structure of Cdt1/geminin complex
PDB Compounds: (D:) Geminin

SCOPe Domain Sequences for d2zxxd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2zxxd_ h.1.28.1 (D:) Geminin coiled-coil domain {Mouse (Mus musculus) [TaxId: 10090]}
sqywkevaeqrrkalyealkeneklhkeieqkdseiarlrkenkdlaevaehvqymaevi
erlsn

SCOPe Domain Coordinates for d2zxxd_:

Click to download the PDB-style file with coordinates for d2zxxd_.
(The format of our PDB-style files is described here.)

Timeline for d2zxxd_: