SCOPe 2.08: Domain d2zxxd_: 2zxx D:

Lineage for d2zxxd_ (2zxx D:)

1. Root: SCOPe 2.08

2. Class h: Coiled coil proteins [57942] (7 folds)

3. Fold h.1: Parallel coiled-coil [57943] (41 superfamilies)
   this is not a true fold; includes oligomers of shorter identical helices

4. Superfamily h.1.28: Geminin coiled-coil domain [111469] (2 families)

5. Family h.1.28.1: Geminin coiled-coil domain [111470] (2 proteins)

6. Protein Geminin coiled-coil domain [111471] (2 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [111473] (1 PDB entry)
   Uniprot O88513 79-156

8. Domain d2zxxd_: 2zxx D: [171599]
   Other proteins in same PDB: d2zxxc_, d2zxxf_
   protein/DNA complex

Details for d2zxxd_

PDB Entry: 2zxx, 2.8 Å

PDB Description: Crystal structure of Cdt1/geminin complex

PDB Compounds: (D:) Geminin

SCOPe Domain Sequences for d2zxxd_:

Sequence; same for both SEQRES and ATOM records:

>d2zxxd_ h.1.28.1 (D:) Geminin coiled-coil domain {Mouse (Mus musculus) [TaxId: 10090]}
sqywkevaeqrrkalyealkeneklhkeieqkdseiarlrkenkdlaevaehvqymaevi
erlsn

Timeline for d2zxxd_:

• d2zxxd_ first appeared in SCOPe 2.01
  
• d2zxxd_ appears in SCOPe 2.07