SCOPe 2.05: Domain d2zxwz_: 2zxw Z:

Lineage for d2zxwz_ (2zxw Z:)

1. Root: SCOPe 2.05

2. Class f: Membrane and cell surface proteins and peptides [56835] (57 folds)

3. Fold f.23: Single transmembrane helix [81407] (40 superfamilies)
   not a true fold

4. Superfamily f.23.7: Mitochondrial cytochrome c oxidase subunit VIIIb (aka IX) [81431] (1 family)
   automatically mapped to Pfam PF02285

5. Family f.23.7.1: Mitochondrial cytochrome c oxidase subunit VIIIb (aka IX) [81430] (2 proteins)

6. Protein automated matches [190273] (1 species)
   not a true protein

7. Species Cow (Bos taurus) [TaxId:9913] [187065] (18 PDB entries)

8. Domain d2zxwz_: 2zxw Z: [171595]
   Other proteins in same PDB: d2zxwa_, d2zxwb1, d2zxwb2, d2zxwc_, d2zxwd_, d2zxwe_, d2zxwf_, d2zxwg_, d2zxwh_, d2zxwi_, d2zxwj_, d2zxwk_, d2zxwl_, d2zxwn_, d2zxwo1, d2zxwo2, d2zxwp_, d2zxwq_, d2zxwr_, d2zxws_, d2zxwt_, d2zxwu_, d2zxwv_, d2zxww_, d2zxwx_, d2zxwy_
   automated match to d1occm_
   complexed with cdl, chd, cu, cua, dmu, hea, mg, na, pek, per, pgv, psc, tgl, unx, zn

Details for d2zxwz_

PDB Entry: 2zxw, 2.5 Å

PDB Description: Bovine heart cytochrome c oxidase at the fully oxidized state (1-s X-ray exposure dataset)

PDB Compounds: (Z:) cytochrome c oxidase polypeptide 8h

SCOPe Domain Sequences for d2zxwz_:

Sequence; same for both SEQRES and ATOM records:

>d2zxwz_ f.23.7.1 (Z:) automated matches {Cow (Bos taurus) [TaxId: 9913]}
itakpaktptspkeqaiglsvtflsfllpagwvlyhldnykks

Timeline for d2zxwz_:

• d2zxwz_ first appeared in SCOPe 2.01
  
• d2zxwz_ appears in SCOPe 2.04
  
• d2zxwz_ appears in SCOPe 2.06
  
• d2zxwz_ appears in the current release, SCOPe 2.08