Lineage for d2zxwx_ (2zxw X:)

  1. Root: SCOPe 2.01
  2. 1058004Class f: Membrane and cell surface proteins and peptides [56835] (57 folds)
  3. 1059389Fold f.23: Single transmembrane helix [81407] (38 superfamilies)
    not a true fold
  4. 1059590Superfamily f.23.5: Mitochondrial cytochrome c oxidase subunit VIIb [81423] (1 family) (S)
  5. 1059591Family f.23.5.1: Mitochondrial cytochrome c oxidase subunit VIIb [81422] (2 proteins)
  6. 1059608Protein automated matches [190272] (1 species)
    not a true protein
  7. 1059609Species Cow (Bos taurus) [TaxId:9913] [187064] (15 PDB entries)
  8. 1059635Domain d2zxwx_: 2zxw X: [171593]
    Other proteins in same PDB: d2zxwa_, d2zxwc_, d2zxwd_, d2zxwe_, d2zxwf_, d2zxwg_, d2zxwh_, d2zxwi_, d2zxwj_, d2zxwl_, d2zxwm_, d2zxwn_, d2zxwp_, d2zxwq_, d2zxwr_, d2zxws_, d2zxwt_, d2zxwu_, d2zxwv_, d2zxww_, d2zxwy_, d2zxwz_
    automated match to d1occk_
    complexed with cdl, chd, cu, cua, dmu, hea, mg, na, pek, per, pgv, psc, tgl, unx, zn

Details for d2zxwx_

PDB Entry: 2zxw (more details), 2.5 Å

PDB Description: Bovine heart cytochrome c oxidase at the fully oxidized state (1-s X-ray exposure dataset)
PDB Compounds: (X:) cytochrome c oxidase polypeptide 7b

SCOPe Domain Sequences for d2zxwx_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2zxwx_ f.23.5.1 (X:) automated matches {Cow (Bos taurus) [TaxId: 9913]}
apdfhdkygnavlasgatfcvavwvymatqigiewnpspvgrvtpkewr

SCOPe Domain Coordinates for d2zxwx_:

Click to download the PDB-style file with coordinates for d2zxwx_.
(The format of our PDB-style files is described here.)

Timeline for d2zxwx_: