SCOPe 2.01: Domain d2zxwu_: 2zxw U:

Lineage for d2zxwu_ (2zxw U:)

1. Root: SCOPe 2.01

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.51: Cytochrome c oxidase subunit h [47693] (1 superfamily)
   4 helices; irregular array, disulfide-linked

4. Superfamily a.51.1: Cytochrome c oxidase subunit h [47694] (1 family)

5. Family a.51.1.1: Cytochrome c oxidase subunit h [47695] (2 proteins)

6. Protein automated matches [190271] (1 species)
   not a true protein

7. Species Cow (Bos taurus) [TaxId:9913] [187063] (16 PDB entries)

8. Domain d2zxwu_: 2zxw U: [171590]
   Other proteins in same PDB: d2zxwa_, d2zxwc_, d2zxwd_, d2zxwe_, d2zxwf_, d2zxwg_, d2zxwi_, d2zxwj_, d2zxwk_, d2zxwl_, d2zxwm_, d2zxwn_, d2zxwp_, d2zxwq_, d2zxwr_, d2zxws_, d2zxwt_, d2zxwv_, d2zxww_, d2zxwx_, d2zxwy_, d2zxwz_
   automated match to d1ocrh_
   complexed with cdl, chd, cu, cua, dmu, hea, mg, na, pek, per, pgv, psc, tgl, unx, zn

Details for d2zxwu_

PDB Entry: 2zxw, 2.5 Å

PDB Description: Bovine heart cytochrome c oxidase at the fully oxidized state (1-s X-ray exposure dataset)

PDB Compounds: (U:) Cytochrome c oxidase subunit VIb isoform 1

SCOPe Domain Sequences for d2zxwu_:

Sequence; same for both SEQRES and ATOM records:

>d2zxwu_ a.51.1.1 (U:) automated matches {Cow (Bos taurus) [TaxId: 9913]}
yqtapfdsrfpnqnqtrncwqnyldfhrcekamtakggdvsvcewyrrvykslcpiswvs
twddrraegtfpgki

Timeline for d2zxwu_:

• d2zxwu_ is new in SCOPe 2.01-stable
  
• d2zxwu_ appears in SCOPe 2.02
  
• d2zxwu_ appears in the current release, SCOPe 2.08