Lineage for d2zxwf_ (2zxw F:)

  1. Root: SCOPe 2.05
  2. 1959977Class g: Small proteins [56992] (92 folds)
  3. 1965821Fold g.41: Rubredoxin-like [57769] (17 superfamilies)
    metal(zinc or iron)-bound fold; sequence contains two CX(n)C motifs, in most cases n = 2
  4. 1966025Superfamily g.41.5: Rubredoxin-like [57802] (4 families) (S)
  5. 1966184Family g.41.5.3: Cytochrome c oxidase Subunit F [57818] (2 proteins)
    membrane-anchored rubredoxin-like domain
    automatically mapped to Pfam PF01215
  6. 1966185Protein Cytochrome c oxidase Subunit F [57819] (1 species)
  7. 1966186Species Cow (Bos taurus) [TaxId:9913] [57820] (26 PDB entries)
  8. 1966223Domain d2zxwf_: 2zxw F: [171576]
    Other proteins in same PDB: d2zxwa_, d2zxwb1, d2zxwb2, d2zxwc_, d2zxwd_, d2zxwe_, d2zxwg_, d2zxwh_, d2zxwi_, d2zxwj_, d2zxwk_, d2zxwl_, d2zxwm_, d2zxwn_, d2zxwo1, d2zxwo2, d2zxwp_, d2zxwq_, d2zxwr_, d2zxwt_, d2zxwu_, d2zxwv_, d2zxww_, d2zxwx_, d2zxwy_, d2zxwz_
    automated match to d1occf_
    complexed with cdl, chd, cu, cua, dmu, hea, mg, na, pek, per, pgv, psc, tgl, unx, zn

Details for d2zxwf_

PDB Entry: 2zxw (more details), 2.5 Å

PDB Description: Bovine heart cytochrome c oxidase at the fully oxidized state (1-s X-ray exposure dataset)
PDB Compounds: (F:) Cytochrome c oxidase subunit 5B

SCOPe Domain Sequences for d2zxwf_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2zxwf_ g.41.5.3 (F:) Cytochrome c oxidase Subunit F {Cow (Bos taurus) [TaxId: 9913]}
ggvptdeeqatglerevmlaarkgqdpynilapkatsgtkedpnlvpsitnkrivgcice
ednstviwfwlhkgeaqrcpscgthyklvphql

SCOPe Domain Coordinates for d2zxwf_:

Click to download the PDB-style file with coordinates for d2zxwf_.
(The format of our PDB-style files is described here.)

Timeline for d2zxwf_: