SCOPe 2.07: Domain d2zxvd_: 2zxv D:

Lineage for d2zxvd_ (2zxv D:)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.108: Acyl-CoA N-acyltransferases (Nat) [55728] (1 superfamily)
   3 layers: a/b/a; contains mixed beta-sheet

4. Superfamily d.108.1: Acyl-CoA N-acyltransferases (Nat) [55729] (11 families)

5. Family d.108.1.0: automated matches [191308] (1 protein)
   not a true family

6. Protein automated matches [190038] (48 species)
   not a true protein

7. Species Thermus thermophilus HB8 [TaxId:300852] [188268] (2 PDB entries)

8. Domain d2zxvd_: 2zxv D: [171571]
   automated match to d1yrea1

Details for d2zxvd_

PDB Entry: 2zxv, 2.3 Å

PDB Description: Crystal structure of putative acetyltransferase from T. thermophilus HB8

PDB Compounds: (D:) Putative uncharacterized protein TTHA1799

SCOPe Domain Sequences for d2zxvd_:

Sequence; same for both SEQRES and ATOM records:

>d2zxvd_ d.108.1.0 (D:) automated matches {Thermus thermophilus HB8 [TaxId: 300852]}
mwafperfegrhvrleplalahlpaflrhydpevyrflsrapvapteealrahlegllge
pgrvnwailfgkevagrisviapepehaklelgtmlfkpfwgspankeakylllrhafev
lraervqfkvdlrnersqralealgavregvlrknrrlpdgafrddvvysvlkeewpgvk
arlearly

Timeline for d2zxvd_:

• d2zxvd_ first appeared in SCOPe 2.01
  
• d2zxvd_ appears in SCOPe 2.06
  
• d2zxvd_ appears in the current release, SCOPe 2.08