Class a: All alpha proteins [46456] (202 folds) |
Fold a.39: EF Hand-like [47472] (4 superfamilies) core: 4 helices; array of 2 hairpins, opened |
Superfamily a.39.1: EF-hand [47473] (10 families) Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop |
Family a.39.1.2: S100 proteins [47478] (1 protein) dimer: subunits are made of two EF-hands |
Protein Calcyclin (S100) [47479] (16 species) |
Species Rabbit (Oryctolagus cuniculus) [TaxId:9986] [47480] (4 PDB entries) |
Domain d1a03a_: 1a03 A: [17157] |
PDB Entry: 1a03 (more details)
SCOP Domain Sequences for d1a03a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1a03a_ a.39.1.2 (A:) Calcyclin (S100) {Rabbit (Oryctolagus cuniculus)} maspldqaiglligifhkysgkegdkhtlskkelkeliqkeltigsklqdaeivklmddl drnkdqevnfqeyitflgalamiynealkg
Timeline for d1a03a_: