![]() | Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
![]() | Fold d.108: Acyl-CoA N-acyltransferases (Nat) [55728] (1 superfamily) 3 layers: a/b/a; contains mixed beta-sheet |
![]() | Superfamily d.108.1: Acyl-CoA N-acyltransferases (Nat) [55729] (11 families) ![]() |
![]() | Family d.108.1.0: automated matches [191308] (1 protein) not a true family |
![]() | Protein automated matches [190038] (22 species) not a true protein |
![]() | Species Thermus thermophilus [TaxId:300852] [188268] (2 PDB entries) |
![]() | Domain d2zxva_: 2zxv A: [171568] automated match to d1yrea1 |
PDB Entry: 2zxv (more details), 2.3 Å
SCOPe Domain Sequences for d2zxva_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2zxva_ d.108.1.0 (A:) automated matches {Thermus thermophilus [TaxId: 300852]} mwafperfegrhvrleplalahlpaflrhydpevyrflsrapvapteealrahlegllge pgrvnwailfgkevagrisviapepehaklelgtmlfkpfwgspankeakylllrhafev lraervqfkvdlrnersqralealgavregvlrknrrlpdgafrddvvysvlkeewpgvk arlearly
Timeline for d2zxva_: