Lineage for d2zxva_ (2zxv A:)

  1. Root: SCOPe 2.03
  2. 1396887Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1426873Fold d.108: Acyl-CoA N-acyltransferases (Nat) [55728] (1 superfamily)
    3 layers: a/b/a; contains mixed beta-sheet
  4. 1426874Superfamily d.108.1: Acyl-CoA N-acyltransferases (Nat) [55729] (11 families) (S)
  5. 1427400Family d.108.1.0: automated matches [191308] (1 protein)
    not a true family
  6. 1427401Protein automated matches [190038] (22 species)
    not a true protein
  7. 1427513Species Thermus thermophilus [TaxId:300852] [188268] (2 PDB entries)
  8. 1427515Domain d2zxva_: 2zxv A: [171568]
    automated match to d1yrea1

Details for d2zxva_

PDB Entry: 2zxv (more details), 2.3 Å

PDB Description: Crystal structure of putative acetyltransferase from T. thermophilus HB8
PDB Compounds: (A:) Putative uncharacterized protein TTHA1799

SCOPe Domain Sequences for d2zxva_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2zxva_ d.108.1.0 (A:) automated matches {Thermus thermophilus [TaxId: 300852]}
mwafperfegrhvrleplalahlpaflrhydpevyrflsrapvapteealrahlegllge
pgrvnwailfgkevagrisviapepehaklelgtmlfkpfwgspankeakylllrhafev
lraervqfkvdlrnersqralealgavregvlrknrrlpdgafrddvvysvlkeewpgvk
arlearly

SCOPe Domain Coordinates for d2zxva_:

Click to download the PDB-style file with coordinates for d2zxva_.
(The format of our PDB-style files is described here.)

Timeline for d2zxva_: