Lineage for d2zwua_ (2zwu A:)

  1. Root: SCOPe 2.03
  2. 1253684Class a: All alpha proteins [46456] (284 folds)
  3. 1277465Fold a.104: Cytochrome P450 [48263] (1 superfamily)
    multihelical
  4. 1277466Superfamily a.104.1: Cytochrome P450 [48264] (2 families) (S)
  5. 1277467Family a.104.1.1: Cytochrome P450 [48265] (23 proteins)
  6. 1277681Protein Cytochrome P450-CAM [48266] (1 species)
  7. 1277682Species Pseudomonas putida [TaxId:303] [48267] (105 PDB entries)
    Uniprot P00183
  8. 1277684Domain d2zwua_: 2zwu A: [171566]
    automated match to d1t87a_
    complexed with cam, hem, k, trs

Details for d2zwua_

PDB Entry: 2zwu (more details), 1.3 Å

PDB Description: crystal structure of camphor soaked ferric cytochrome p450cam
PDB Compounds: (A:) Camphor 5-monooxygenase

SCOPe Domain Sequences for d2zwua_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2zwua_ a.104.1.1 (A:) Cytochrome P450-CAM {Pseudomonas putida [TaxId: 303]}
nlaplpphvpehlvfdfdmynpsnlsagvqeawavlqesnvpdlvwtrcngghwiatrgq
lireayedyrhfssecpfipreageaydfiptsmdppeqrqfralanqvvgmpvvdklen
riqelacslieslrpqgqcnftedyaepfpirifmllaglpeediphlkyltdqmtrpdg
smtfaeakealydylipiieqrrqkpgtdaisivangqvngrpitsdeakrmcglllvgg
ldtvvnflsfsmeflakspehrqelierperipaaceellrrfslvadgriltsdyefhg
vqlkkgdqillpqmlsglderenacpmhvdfsrqkvshttfghgshlclgqhlarreiiv
tlkewltripdfsiapgaqiqhksgivsgvqalplvwdpattkav

SCOPe Domain Coordinates for d2zwua_:

Click to download the PDB-style file with coordinates for d2zwua_.
(The format of our PDB-style files is described here.)

Timeline for d2zwua_: