SCOPe 2.05: Domain d2zwib_: 2zwi B:

Lineage for d2zwib_ (2zwi B:)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.87: UDP-Glycosyltransferase/glycogen phosphorylase [53755] (1 superfamily)
   consists of two non-similar domains with 3 layers (a/b/a) each
   domain 1: parallel beta-sheet of 7 strands, order 3214567
   domain 2: parallel beta-sheet of 6 strands, order 321456

4. Superfamily c.87.1: UDP-Glycosyltransferase/glycogen phosphorylase [53756] (13 families)

5. Family c.87.1.0: automated matches [191559] (1 protein)
   not a true family

6. Protein automated matches [190965] (12 species)
   not a true protein

7. Species Photobacterium phosphoreum [TaxId:659] [188922] (1 PDB entry)

8. Domain d2zwib_: 2zwi B: [171561]
   automated match to d2ex1a1
   complexed with c5p, cl, gol, zn

Details for d2zwib_

PDB Entry: 2zwi, 2.01 Å

PDB Description: Crystal structure of alpha/beta-Galactoside alpha-2,3-Sialyltransferase from a Luminous Marine Bacterium, Photobacterium phosphoreum

PDB Compounds: (B:) Alpha-/beta-galactoside alpha-2,3-sialyltransferase

SCOPe Domain Sequences for d2zwib_:

Sequence; same for both SEQRES and ATOM records:

>d2zwib_ c.87.1.0 (B:) automated matches {Photobacterium phosphoreum [TaxId: 659]}
knktievyvdratlptiqqmtqiinensnnkkliswsrypindetllesingsffknrpe
liksldsmiltneikkviingntlwavdvvniiksiealgkkteielnfyddgsaeyvrl
ydfsrlpeseqeykislskdniqssingtqpfdnsieniygfsqlypttyhmlradifet
nlpltslkrvisnnikqmkwdyfttfnsqqknkfynftgfnpekikeqykasphenfifi
gtnsgtataeqqidilteakkpdspiitnsiqgldlffkghpsatynqqiidahnmieiy
nkipfealimtdalpdavggmgssvffslpntvenkfifyksdtdiennaliqvmielni
vnrndvklisdlq

Timeline for d2zwib_:

• d2zwib_ first appeared in SCOPe 2.01
  
• d2zwib_ appears in SCOPe 2.04
  
• d2zwib_ appears in SCOPe 2.06
  
• d2zwib_ appears in the current release, SCOPe 2.08