Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.87: UDP-Glycosyltransferase/glycogen phosphorylase [53755] (1 superfamily) consists of two non-similar domains with 3 layers (a/b/a) each domain 1: parallel beta-sheet of 7 strands, order 3214567 domain 2: parallel beta-sheet of 6 strands, order 321456 |
Superfamily c.87.1: UDP-Glycosyltransferase/glycogen phosphorylase [53756] (13 families) |
Family c.87.1.0: automated matches [191559] (1 protein) not a true family |
Protein automated matches [190965] (12 species) not a true protein |
Species Photobacterium phosphoreum [TaxId:659] [188922] (1 PDB entry) |
Domain d2zwib_: 2zwi B: [171561] automated match to d2ex1a1 complexed with c5p, cl, gol, zn |
PDB Entry: 2zwi (more details), 2.01 Å
SCOPe Domain Sequences for d2zwib_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2zwib_ c.87.1.0 (B:) automated matches {Photobacterium phosphoreum [TaxId: 659]} knktievyvdratlptiqqmtqiinensnnkkliswsrypindetllesingsffknrpe liksldsmiltneikkviingntlwavdvvniiksiealgkkteielnfyddgsaeyvrl ydfsrlpeseqeykislskdniqssingtqpfdnsieniygfsqlypttyhmlradifet nlpltslkrvisnnikqmkwdyfttfnsqqknkfynftgfnpekikeqykasphenfifi gtnsgtataeqqidilteakkpdspiitnsiqgldlffkghpsatynqqiidahnmieiy nkipfealimtdalpdavggmgssvffslpntvenkfifyksdtdiennaliqvmielni vnrndvklisdlq
Timeline for d2zwib_: