Lineage for d2zwia_ (2zwi A:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2142044Fold c.87: UDP-Glycosyltransferase/glycogen phosphorylase [53755] (1 superfamily)
    consists of two non-similar domains with 3 layers (a/b/a) each
    domain 1: parallel beta-sheet of 7 strands, order 3214567
    domain 2: parallel beta-sheet of 6 strands, order 321456
  4. 2142045Superfamily c.87.1: UDP-Glycosyltransferase/glycogen phosphorylase [53756] (14 families) (S)
  5. 2142537Family c.87.1.0: automated matches [191559] (1 protein)
    not a true family
  6. 2142538Protein automated matches [190965] (26 species)
    not a true protein
  7. 2142576Species Photobacterium phosphoreum [TaxId:659] [188922] (1 PDB entry)
  8. 2142577Domain d2zwia_: 2zwi A: [171560]
    automated match to d2ex1a1
    complexed with c5p, cl, gol, zn

Details for d2zwia_

PDB Entry: 2zwi (more details), 2.01 Å

PDB Description: Crystal structure of alpha/beta-Galactoside alpha-2,3-Sialyltransferase from a Luminous Marine Bacterium, Photobacterium phosphoreum
PDB Compounds: (A:) Alpha-/beta-galactoside alpha-2,3-sialyltransferase

SCOPe Domain Sequences for d2zwia_:

Sequence, based on SEQRES records: (download)

>d2zwia_ c.87.1.0 (A:) automated matches {Photobacterium phosphoreum [TaxId: 659]}
knktievyvdratlptiqqmtqiinensnnkkliswsrypindetllesingsffknrpe
liksldsmiltneikkviingntlwavdvvniiksiealgkkteielnfyddgsaeyvrl
ydfsrlpeseqeykislskdniqssingtqpfdnsieniygfsqlypttyhmlradifet
nlpltslkrvisnnikqmkwdyfttfnsqqknkfynftgfnpekikeqykasphenfifi
gtnsgtataeqqidilteakkpdspiitnsiqgldlffkghpsatynqqiidahnmieiy
nkipfealimtdalpdavggmgssvffslpntvenkfifyksdtdiennaliqvmielni
vnrndvklisdl

Sequence, based on observed residues (ATOM records): (download)

>d2zwia_ c.87.1.0 (A:) automated matches {Photobacterium phosphoreum [TaxId: 659]}
knktievyvdratlptiqqmtqiinensnnkkliswsrypindetllesingsffknrpe
liksldsmiltneikkviingntlwavdvvniiksiealgkkteielnfyddgsaeyvrl
ydfsrlpeseqeykislskdniqssingtqpfdnsieniygfsqlypttyhmlradifet
nlpltslkrvisnnikqmkwdyfttfnsqqknkfynftgfnpekikeqykasphenfifi
gtnsgtataeqqidilteakkpdspiitnsiqgldlffkghpsatynqqiidahnmieiy
nkipfealimtdalpdavggmgssvffslpntvenkfifyksdiennaliqvmielnivn
rndvklisdl

SCOPe Domain Coordinates for d2zwia_:

Click to download the PDB-style file with coordinates for d2zwia_.
(The format of our PDB-style files is described here.)

Timeline for d2zwia_: