Lineage for d1cb1__ (1cb1 -)

  1. Root: SCOP 1.57
  2. 43951Class a: All alpha proteins [46456] (144 folds)
  3. 47511Fold a.39: EF Hand-like [47472] (3 superfamilies)
  4. 47512Superfamily a.39.1: EF-hand [47473] (8 families) (S)
  5. 47513Family a.39.1.1: Calbindin D9K [47474] (1 protein)
  6. 47514Protein Calbindin D9K [47475] (2 species)
  7. 47530Species Pig (Sus scrofa) [TaxId:9823] [47477] (1 PDB entry)
  8. 47531Domain d1cb1__: 1cb1 - [17156]

Details for d1cb1__

PDB Entry: 1cb1 (more details)

PDB Description: three-dimensional solution structure of ca2+-loaded porcine calbindin d9k determined by nuclear magnetic resonance spectroscopy

SCOP Domain Sequences for d1cb1__:

Sequence; same for both SEQRES and ATOM records: (download)

>d1cb1__ a.39.1.1 (-) Calbindin D9K {Pig (Sus scrofa)}
saqkspaelksifekyaakegdpnqlskeelkqliqaefpsllkgprtlddlfqeldkng
dgevsfeefqvlvkkisq

SCOP Domain Coordinates for d1cb1__:

Click to download the PDB-style file with coordinates for d1cb1__.
(The format of our PDB-style files is described here.)

Timeline for d1cb1__: