![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.39: EF Hand-like [47472] (4 superfamilies) core: 4 helices; array of 2 hairpins, opened |
![]() | Superfamily a.39.1: EF-hand [47473] (12 families) ![]() Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop |
![]() | Family a.39.1.1: Calbindin D9K [47474] (2 proteins) made of two EF-hands only |
![]() | Protein Calbindin D9K [47475] (2 species) |
![]() | Species Pig (Sus scrofa) [TaxId:9823] [47477] (1 PDB entry) |
![]() | Domain d1cb1a_: 1cb1 A: [17156] |
PDB Entry: 1cb1 (more details)
SCOPe Domain Sequences for d1cb1a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1cb1a_ a.39.1.1 (A:) Calbindin D9K {Pig (Sus scrofa) [TaxId: 9823]} saqkspaelksifekyaakegdpnqlskeelkqliqaefpsllkgprtlddlfqeldkng dgevsfeefqvlvkkisq
Timeline for d1cb1a_: