Lineage for d1cb1a_ (1cb1 A:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2710066Fold a.39: EF Hand-like [47472] (4 superfamilies)
    core: 4 helices; array of 2 hairpins, opened
  4. 2710067Superfamily a.39.1: EF-hand [47473] (12 families) (S)
    Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop
  5. 2710068Family a.39.1.1: Calbindin D9K [47474] (2 proteins)
    made of two EF-hands only
  6. 2710069Protein Calbindin D9K [47475] (2 species)
  7. 2710093Species Pig (Sus scrofa) [TaxId:9823] [47477] (1 PDB entry)
  8. 2710094Domain d1cb1a_: 1cb1 A: [17156]

Details for d1cb1a_

PDB Entry: 1cb1 (more details)

PDB Description: three-dimensional solution structure of ca2+-loaded porcine calbindin d9k determined by nuclear magnetic resonance spectroscopy
PDB Compounds: (A:) calbindin d9k

SCOPe Domain Sequences for d1cb1a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1cb1a_ a.39.1.1 (A:) Calbindin D9K {Pig (Sus scrofa) [TaxId: 9823]}
saqkspaelksifekyaakegdpnqlskeelkqliqaefpsllkgprtlddlfqeldkng
dgevsfeefqvlvkkisq

SCOPe Domain Coordinates for d1cb1a_:

Click to download the PDB-style file with coordinates for d1cb1a_.
(The format of our PDB-style files is described here.)

Timeline for d1cb1a_: