| Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
| Fold d.284: PurS-like [109622] (1 superfamily) consists of two alpha+beta subdomains with some similarity to the ferredoxin-like fold |
Superfamily d.284.1: PurS-like [82697] (3 families) ![]() segment-swapped dimer: the swapped segment is made of the first helix and second strand; a single long strand is formed by strands 2 and 3 of each subunit |
| Family d.284.1.0: automated matches [191523] (1 protein) not a true family |
| Protein automated matches [190881] (2 species) not a true protein |
| Species Sulfolobus tokodaii [TaxId:111955] [189125] (1 PDB entry) |
| Domain d2zw2b_: 2zw2 B: [171558] automated match to d1vq3a_ complexed with gol |
PDB Entry: 2zw2 (more details), 1.55 Å
SCOPe Domain Sequences for d2zw2b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2zw2b_ d.284.1.0 (B:) automated matches {Sulfolobus tokodaii [TaxId: 111955]}
mlyrveliitnkegvrdpegetiqryvvsrfsdkiietragkylvfrvnsssqqeatelv
kklademrlynpivhkieiranrie
Timeline for d2zw2b_: