Lineage for d2zw2a_ (2zw2 A:)

  1. Root: SCOPe 2.02
  2. 1190016Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1231141Fold d.284: PurS-like [109622] (1 superfamily)
    consists of two alpha+beta subdomains with some similarity to the ferredoxin-like fold
  4. 1231142Superfamily d.284.1: PurS-like [82697] (3 families) (S)
    segment-swapped dimer: the swapped segment is made of the first helix and second strand; a single long strand is formed by strands 2 and 3 of each subunit
  5. 1231164Family d.284.1.0: automated matches [191523] (1 protein)
    not a true family
  6. 1231165Protein automated matches [190881] (2 species)
    not a true protein
  7. 1231168Species Sulfolobus tokodaii [TaxId:111955] [189125] (1 PDB entry)
  8. 1231169Domain d2zw2a_: 2zw2 A: [171557]
    automated match to d1vq3a_
    complexed with gol

Details for d2zw2a_

PDB Entry: 2zw2 (more details), 1.55 Å

PDB Description: crystal structure of formylglycinamide ribonucleotide amidotransferase iii from sulfolobus tokodaii (stpurs)
PDB Compounds: (A:) Putative uncharacterized protein STS178

SCOPe Domain Sequences for d2zw2a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2zw2a_ d.284.1.0 (A:) automated matches {Sulfolobus tokodaii [TaxId: 111955]}
mlyrveliitnkegvrdpegetiqryvvsrfsdkiietragkylvfrvnsssqqeatelv
kklademrlynpivhkieiranrie

SCOPe Domain Coordinates for d2zw2a_:

Click to download the PDB-style file with coordinates for d2zw2a_.
(The format of our PDB-style files is described here.)

Timeline for d2zw2a_: