SCOPe 2.08: Domain d2zw2a_: 2zw2 A:

Lineage for d2zw2a_ (2zw2 A:)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.284: PurS-like [109622] (1 superfamily)
   consists of two alpha+beta subdomains with some similarity to the ferredoxin-like fold

4. Superfamily d.284.1: PurS-like [82697] (3 families)
   segment-swapped dimer: the swapped segment is made of the first helix and second strand; a single long strand is formed by strands 2 and 3 of each subunit

5. Family d.284.1.0: automated matches [191523] (1 protein)
   not a true family

6. Protein automated matches [190881] (2 species)
   not a true protein

7. Species Sulfolobus tokodaii [TaxId:111955] [189125] (1 PDB entry)

8. Domain d2zw2a_: 2zw2 A: [171557]
   automated match to d1vq3a_
   complexed with gol

Details for d2zw2a_

PDB Entry: 2zw2, 1.55 Å

PDB Description: crystal structure of formylglycinamide ribonucleotide amidotransferase iii from sulfolobus tokodaii (stpurs)

PDB Compounds: (A:) Putative uncharacterized protein STS178

SCOPe Domain Sequences for d2zw2a_:

Sequence; same for both SEQRES and ATOM records:

>d2zw2a_ d.284.1.0 (A:) automated matches {Sulfolobus tokodaii [TaxId: 111955]}
mlyrveliitnkegvrdpegetiqryvvsrfsdkiietragkylvfrvnsssqqeatelv
kklademrlynpivhkieiranrie

Timeline for d2zw2a_:

• d2zw2a_ first appeared in SCOPe 2.01
  
• d2zw2a_ appears in SCOPe 2.07