Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies) core: beta(2)-alpha-beta(2); mixed beta-sheet 2143 |
Superfamily d.15.7: Immunoglobulin-binding domains [54358] (1 family) |
Family d.15.7.1: Immunoglobulin-binding domains [54359] (3 proteins) |
Protein automated matches [190067] (6 species) not a true protein |
Species Finegoldia magna [TaxId:1260] [188811] (5 PDB entries) |
Domain d2zw1a_: 2zw1 A: [171556] automated match to d1gb1a_ mutant |
PDB Entry: 2zw1 (more details), 1.6 Å
SCOPe Domain Sequences for d2zw1a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2zw1a_ d.15.7.1 (A:) automated matches {Finegoldia magna [TaxId: 1260]} mdtyklilngktlkgettteavdaataekvfkhyanehgvhghwtydpetktftvte
Timeline for d2zw1a_: