Lineage for d2zw1a_ (2zw1 A:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2931196Fold d.15: beta-Grasp (ubiquitin-like) [54235] (15 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 2934642Superfamily d.15.7: Immunoglobulin-binding domains [54358] (1 family) (S)
  5. 2934643Family d.15.7.1: Immunoglobulin-binding domains [54359] (3 proteins)
  6. 2934772Protein automated matches [190067] (6 species)
    not a true protein
  7. 2934778Species Finegoldia magna [TaxId:1260] [188811] (8 PDB entries)
  8. 2934780Domain d2zw1a_: 2zw1 A: [171556]
    automated match to d1gb1a_
    mutant

Details for d2zw1a_

PDB Entry: 2zw1 (more details), 1.6 Å

PDB Description: crystal structure of a streptococcal protein g b1 mutant
PDB Compounds: (A:) Protein LG

SCOPe Domain Sequences for d2zw1a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2zw1a_ d.15.7.1 (A:) automated matches {Finegoldia magna [TaxId: 1260]}
mdtyklilngktlkgettteavdaataekvfkhyanehgvhghwtydpetktftvte

SCOPe Domain Coordinates for d2zw1a_:

Click to download the PDB-style file with coordinates for d2zw1a_.
(The format of our PDB-style files is described here.)

Timeline for d2zw1a_: