Lineage for d2zw0a_ (2zw0 A:)

  1. Root: SCOPe 2.01
  2. 1013083Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1017615Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 1018933Superfamily d.15.7: Immunoglobulin-binding domains [54358] (1 family) (S)
  5. 1018934Family d.15.7.1: Immunoglobulin-binding domains [54359] (3 proteins)
  6. 1019014Protein automated matches [190067] (3 species)
    not a true protein
  7. 1019015Species Finegoldia magna [TaxId:1260] [188811] (2 PDB entries)
  8. 1019016Domain d2zw0a_: 2zw0 A: [171555]
    automated match to d1gb1a_
    complexed with so4; mutant

Details for d2zw0a_

PDB Entry: 2zw0 (more details), 1.4 Å

PDB Description: crystal structure of a streptococcal protein g b1 mutant
PDB Compounds: (A:) Protein LG

SCOPe Domain Sequences for d2zw0a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2zw0a_ d.15.7.1 (A:) automated matches {Finegoldia magna [TaxId: 1260]}
mdtyklilngktlkgettteavdaataekvfkqyanehgvdgewtydpetktftvte

SCOPe Domain Coordinates for d2zw0a_:

Click to download the PDB-style file with coordinates for d2zw0a_.
(The format of our PDB-style files is described here.)

Timeline for d2zw0a_: