| Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
| Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies) core: beta(2)-alpha-beta(2); mixed beta-sheet 2143 |
Superfamily d.15.7: Immunoglobulin-binding domains [54358] (1 family) ![]() |
| Family d.15.7.1: Immunoglobulin-binding domains [54359] (3 proteins) |
| Protein automated matches [190067] (3 species) not a true protein |
| Species Finegoldia magna [TaxId:1260] [188811] (2 PDB entries) |
| Domain d2zw0a_: 2zw0 A: [171555] automated match to d1gb1a_ complexed with so4; mutant |
PDB Entry: 2zw0 (more details), 1.4 Å
SCOPe Domain Sequences for d2zw0a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2zw0a_ d.15.7.1 (A:) automated matches {Finegoldia magna [TaxId: 1260]}
mdtyklilngktlkgettteavdaataekvfkqyanehgvdgewtydpetktftvte
Timeline for d2zw0a_: