Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
Fold d.58: Ferredoxin-like [54861] (59 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
Superfamily d.58.1: 4Fe-4S ferredoxins [54862] (6 families) |
Family d.58.1.1: Short-chain ferredoxins [54863] (2 proteins) contains two 4Fe-4S clusters |
Protein automated matches [190638] (3 species) not a true protein |
Species Escherichia coli K-12 [TaxId:83333] [189040] (1 PDB entry) |
Domain d2zvsb_: 2zvs B: [171550] automated match to d1blua_ complexed with sf4 |
PDB Entry: 2zvs (more details), 1.65 Å
SCOPe Domain Sequences for d2zvsb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2zvsb_ d.58.1.1 (B:) automated matches {Escherichia coli K-12 [TaxId: 83333]} allitkkcincdmcepecpneaismgdhiyeinsdkctecvghyetptcqkvcpipntiv kdpahveteeqlwdkfvlmh
Timeline for d2zvsb_: