SCOPe 2.01: Domain d2zvsb_: 2zvs B:

Lineage for d2zvsb_ (2zvs B:)

1. Root: SCOPe 2.01

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.1: 4Fe-4S ferredoxins [54862] (6 families)

5. Family d.58.1.1: Short-chain ferredoxins [54863] (2 proteins)
   contains two 4Fe-4S clusters

6. Protein automated matches [190638] (3 species)
   not a true protein

7. Species Escherichia coli K-12 [TaxId:83333] [189040] (1 PDB entry)

8. Domain d2zvsb_: 2zvs B: [171550]
   automated match to d1blua_
   complexed with sf4

Details for d2zvsb_

PDB Entry: 2zvs, 1.65 Å

PDB Description: Crystal structure of the 2[4FE-4S] ferredoxin from escherichia coli

PDB Compounds: (B:) Uncharacterized ferredoxin-like protein yfhL

SCOPe Domain Sequences for d2zvsb_:

Sequence; same for both SEQRES and ATOM records:

>d2zvsb_ d.58.1.1 (B:) automated matches {Escherichia coli K-12 [TaxId: 83333]}
allitkkcincdmcepecpneaismgdhiyeinsdkctecvghyetptcqkvcpipntiv
kdpahveteeqlwdkfvlmh

Timeline for d2zvsb_:

• d2zvsb_ is new in SCOPe 2.01-stable
  
• d2zvsb_ appears in SCOPe 2.02
  
• d2zvsb_ appears in the current release, SCOPe 2.08