Lineage for d2zvsa_ (2zvs A:)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1906287Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 1906288Superfamily d.58.1: 4Fe-4S ferredoxins [54862] (7 families) (S)
  5. 1906289Family d.58.1.1: Short-chain ferredoxins [54863] (2 proteins)
    contains two 4Fe-4S clusters
  6. 1906303Protein automated matches [190638] (3 species)
    not a true protein
  7. 1906307Species Escherichia coli K-12 [TaxId:83333] [189040] (1 PDB entry)
  8. 1906308Domain d2zvsa_: 2zvs A: [171549]
    automated match to d1blua_
    complexed with sf4

Details for d2zvsa_

PDB Entry: 2zvs (more details), 1.65 Å

PDB Description: Crystal structure of the 2[4FE-4S] ferredoxin from escherichia coli
PDB Compounds: (A:) Uncharacterized ferredoxin-like protein yfhL

SCOPe Domain Sequences for d2zvsa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2zvsa_ d.58.1.1 (A:) automated matches {Escherichia coli K-12 [TaxId: 83333]}
allitkkcincdmcepecpneaismgdhiyeinsdkctecvghyetptcqkvcpipntiv
kdpahveteeqlwdkfvlmhh

SCOPe Domain Coordinates for d2zvsa_:

Click to download the PDB-style file with coordinates for d2zvsa_.
(The format of our PDB-style files is described here.)

Timeline for d2zvsa_: