Lineage for d1bod__ (1bod -)
- Root: SCOP 1.61
Class a: All alpha proteins [46456] (151 folds) 
Fold a.39: EF Hand-like [47472] (4 superfamilies) Superfamily a.39.1: EF-hand [47473] (8 families) 
Family a.39.1.1: Calbindin D9K [47474] (1 protein) Protein Calbindin D9K [47475] (2 species) Species Cow (Bos taurus) [TaxId:9913] [47476] (16 PDB entries) 
Domain d1bod__: 1bod - [17154]
Details for d1bod__
PDB Entry: 1bod (more details)
PDB Description: the solution structures of mutant calbindin d9k's, as determined by nmr, show that the calcium binding site can adopt different folds
SCOP Domain Sequences for d1bod__:
Sequence; same for both SEQRES and ATOM records: (download)
>d1bod__ a.39.1.1 (-) Calbindin D9K {Cow (Bos taurus)}
mkspeelkgifekydkegdgqlskeelklllqtefpsllkgmstldelfeeldkngdgev
sfeefqvlvkkisq
SCOP Domain Coordinates for d1bod__:
Click to download the PDB-style file with coordinates for d1bod__.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1bod__:
- d1bod__ first appeared (with stable ids) in SCOP 1.55
- d1bod__ appears in SCOP 1.59
- d1bod__ appears in SCOP 1.63
- d1bod__ appears in the current release, SCOPe 2.08, called d1boda_
View in 3D