SCOP 1.59: Domain d1bod__: 1bod -

Lineage for d1bod__ (1bod -)

1. Root: SCOP 1.59

2. Class a: All alpha proteins [46456] (151 folds)

3. Fold a.39: EF Hand-like [47472] (4 superfamilies)

4. Superfamily a.39.1: EF-hand [47473] (8 families)

5. Family a.39.1.1: Calbindin D9K [47474] (1 protein)

6. Protein Calbindin D9K [47475] (2 species)

7. Species Cow (Bos taurus) [TaxId:9913] [47476] (16 PDB entries)

8. Domain d1bod__: 1bod - [17154]

Details for d1bod__

PDB Entry: 1bod

PDB Description: the solution structures of mutant calbindin d9k's, as determined by nmr, show that the calcium binding site can adopt different folds

SCOP Domain Sequences for d1bod__:

Sequence; same for both SEQRES and ATOM records:

>d1bod__ a.39.1.1 (-) Calbindin D9K {Cow (Bos taurus)}
mkspeelkgifekydkegdgqlskeelklllqtefpsllkgmstldelfeeldkngdgev
sfeefqvlvkkisq

Timeline for d1bod__:

• d1bod__ first appeared (with stable ids) in SCOP 1.55
  
• d1bod__ appears in SCOP 1.57
  
• d1bod__ appears in SCOP 1.61
  
• d1bod__ appears in the current release, SCOPe 2.08, called d1boda_