SCOPe 2.08: Domain d1boda_: 1bod A:

Lineage for d1boda_ (1bod A:)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.39: EF Hand-like [47472] (4 superfamilies)
   core: 4 helices; array of 2 hairpins, opened

4. Superfamily a.39.1: EF-hand [47473] (12 families)
   Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop

5. Family a.39.1.1: Calbindin D9K [47474] (2 proteins)
   made of two EF-hands only

6. Protein Calbindin D9K [47475] (2 species)

7. Species Cow (Bos taurus) [TaxId:9913] [47476] (20 PDB entries)
   Uniprot P02633

8. Domain d1boda_: 1bod A: [17154]
   mutant

Details for d1boda_

PDB Entry: 1bod

PDB Description: the solution structures of mutant calbindin d9k's, as determined by nmr, show that the calcium binding site can adopt different folds

PDB Compounds: (A:) calbindin d9k

SCOPe Domain Sequences for d1boda_:

Sequence; same for both SEQRES and ATOM records:

>d1boda_ a.39.1.1 (A:) Calbindin D9K {Cow (Bos taurus) [TaxId: 9913]}
mkspeelkgifekydkegdgqlskeelklllqtefpsllkgmstldelfeeldkngdgev
sfeefqvlvkkisq

Timeline for d1boda_:

• d1boda_ first appeared (with stable ids) in SCOP 1.55, called d1bod__
  
• d1boda_ appears in SCOPe 2.07