Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.131: Peptidyl-tRNA hydrolase II [102461] (1 superfamily) 3 layers: a/b/a; mixed beta-sheet of 4 strands, order 2143, strand 4 is antiparallel to the rest |
Superfamily c.131.1: Peptidyl-tRNA hydrolase II [102462] (2 families) |
Family c.131.1.0: automated matches [191421] (1 protein) not a true family |
Protein automated matches [190592] (3 species) not a true protein |
Species Methanocaldococcus jannaschii [TaxId:243232] [188887] (1 PDB entry) |
Domain d2zv3d_: 2zv3 D: [171537] automated match to d1q7sa_ |
PDB Entry: 2zv3 (more details), 2.1 Å
SCOPe Domain Sequences for d2zv3d_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2zv3d_ c.131.1.0 (D:) automated matches {Methanocaldococcus jannaschii [TaxId: 243232]} mkmvvvirndlgmgkgkmvaqgghaiieafldakrknpravdewlregqkkvvvkvnsek elidiynkarseglpcsiirdaghtqlepgtltavaigpekdekidkitghlkll
Timeline for d2zv3d_: