Lineage for d2zv3c_ (2zv3 C:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2923056Fold c.131: Peptidyl-tRNA hydrolase II [102461] (1 superfamily)
    3 layers: a/b/a; mixed beta-sheet of 4 strands, order 2143, strand 4 is antiparallel to the rest
  4. 2923057Superfamily c.131.1: Peptidyl-tRNA hydrolase II [102462] (2 families) (S)
  5. 2923077Family c.131.1.0: automated matches [191421] (1 protein)
    not a true family
  6. 2923078Protein automated matches [190592] (3 species)
    not a true protein
  7. 2923079Species Methanocaldococcus jannaschii [TaxId:243232] [188887] (1 PDB entry)
  8. 2923082Domain d2zv3c_: 2zv3 C: [171536]
    automated match to d1q7sa_

Details for d2zv3c_

PDB Entry: 2zv3 (more details), 2.1 Å

PDB Description: Crystal structure of project MJ0051 from Methanocaldococcus jannaschii DSM 2661
PDB Compounds: (C:) Peptidyl-tRNA hydrolase

SCOPe Domain Sequences for d2zv3c_:

Sequence, based on SEQRES records: (download)

>d2zv3c_ c.131.1.0 (C:) automated matches {Methanocaldococcus jannaschii [TaxId: 243232]}
mkmvvvirndlgmgkgkmvaqgghaiieafldakrknpravdewlregqkkvvvkvnsek
elidiynkarseglpcsiirdaghtqlepgtltavaigpekdekidkitghlkll

Sequence, based on observed residues (ATOM records): (download)

>d2zv3c_ c.131.1.0 (C:) automated matches {Methanocaldococcus jannaschii [TaxId: 243232]}
mkmvvvirndlgmgkgkmvaqgghaiieafldakrknpravdewlregqkkvvvkvnsek
elidiynkarseglpcsiirdaghpgtltavaigpekdekidkitghlkll

SCOPe Domain Coordinates for d2zv3c_:

Click to download the PDB-style file with coordinates for d2zv3c_.
(The format of our PDB-style files is described here.)

Timeline for d2zv3c_: