Class b: All beta proteins [48724] (177 folds) |
Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily) barrel, closed; n=6, S=8; greek-key duplication: consists of two domains of the same fold |
Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) |
Family b.47.1.4: Viral cysteine protease of trypsin fold [50603] (5 proteins) |
Protein automated matches [190384] (19 species) not a true protein |
Species Human coxsackievirus [TaxId:12072] [188739] (11 PDB entries) |
Domain d2zu3a_: 2zu3 A: [171527] automated match to d1l1na_ complexed with zu3 |
PDB Entry: 2zu3 (more details), 1.75 Å
SCOPe Domain Sequences for d2zu3a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2zu3a_ b.47.1.4 (A:) automated matches {Human coxsackievirus [TaxId: 12072]} gpafefavammkrnsstvkteygeftmlgiydrwavlprhakpgptilmndqevgvldak elvdkdgtnleltllklnrnekfrdirgflakeevevneavlaintskfpnmyipvgqvt eygflnlggtptkrmlmynfptragqcggvlmstgkvlgihvggnghqgfsaallkhyfn
Timeline for d2zu3a_: