SCOPe 2.06: Domain d2zu3a_: 2zu3 A:

Lineage for d2zu3a_ (2zu3 A:)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
   barrel, closed; n=6, S=8; greek-key
   duplication: consists of two domains of the same fold

4. Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families)

5. Family b.47.1.4: Viral cysteine protease of trypsin fold [50603] (5 proteins)

6. Protein automated matches [190384] (19 species)
   not a true protein

7. Species Human coxsackievirus [TaxId:12072] [188739] (11 PDB entries)

8. Domain d2zu3a_: 2zu3 A: [171527]
   automated match to d1l1na_
   complexed with zu3

Details for d2zu3a_

PDB Entry: 2zu3, 1.75 Å

PDB Description: Complex structure of CVB3 3C protease with TG-0204998

PDB Compounds: (A:) 3C proteinase

SCOPe Domain Sequences for d2zu3a_:

Sequence; same for both SEQRES and ATOM records:

>d2zu3a_ b.47.1.4 (A:) automated matches {Human coxsackievirus [TaxId: 12072]}
gpafefavammkrnsstvkteygeftmlgiydrwavlprhakpgptilmndqevgvldak
elvdkdgtnleltllklnrnekfrdirgflakeevevneavlaintskfpnmyipvgqvt
eygflnlggtptkrmlmynfptragqcggvlmstgkvlgihvggnghqgfsaallkhyfn

Timeline for d2zu3a_:

• d2zu3a_ first appeared in SCOPe 2.01
  
• d2zu3a_ appears in SCOPe 2.05
  
• d2zu3a_ appears in SCOPe 2.07
  
• d2zu3a_ appears in the current release, SCOPe 2.08