SCOPe 2.01: Domain d2zu2b_: 2zu2 B:

Lineage for d2zu2b_ (2zu2 B:)

1. Root: SCOPe 2.01

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
   barrel, closed; n=6, S=8; greek-key
   duplication: consists of two domains of the same fold

4. Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families)

5. Family b.47.1.4: Viral cysteine protease of trypsin fold [50603] (4 proteins)

6. Protein Coronavirus main proteinase (3Cl-pro, putative coronavirus nsp2) [74979] (5 species)
   contains an extra alpha-helical domain

7. Species Human coronavirus 229E [TaxId:11137] [89348] (2 PDB entries)

8. Domain d2zu2b_: 2zu2 B: [171526]
   automated match to d1p9sa_
   complexed with dtz, mpd

Details for d2zu2b_

PDB Entry: 2zu2, 1.8 Å

PDB Description: complex structure of CoV 229E 3CL protease with EPDTC

PDB Compounds: (B:) 3C-like proteinase

SCOPe Domain Sequences for d2zu2b_:

Sequence; same for both SEQRES and ATOM records:

>d2zu2b_ b.47.1.4 (B:) Coronavirus main proteinase (3Cl-pro, putative coronavirus nsp2) {Human coronavirus 229E [TaxId: 11137]}
aglrkmaqpsgfvekcvvrvcygntvlnglwlgdivycprhviasnttsaidydheysim
rlhnfsiisgtaflgvvgatmhgvtlkikvsqtnmhtprhsfrtlksgegfnilacydgc
aqgvfgvnmrtnwtirgsfingacgspgynlkngevefvymhqielgsgshvgssfdgvm
yggfedqpnlqvesanqmltvnvvaflyaailngctwwlkgeklfvehynewaqangfta
mngedafsilaaktgvcverllhaiqvlnngfggkqilgysslndefsinevvkqmfgvn
l

Timeline for d2zu2b_:

• d2zu2b_ is new in SCOPe 2.01-stable
  
• d2zu2b_ appears in SCOPe 2.02
  
• d2zu2b_ appears in the current release, SCOPe 2.08