SCOPe 2.01: Domain d2zu0b_: 2zu0 B:

Lineage for d2zu0b_ (2zu0 B:)

1. Root: SCOPe 2.01

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.80: Single-stranded right-handed beta-helix [51125] (8 superfamilies)
   superhelix turns are made of parallel beta-strands and (short) turns

4. Superfamily b.80.6: Stabilizer of iron transporter SufD [101960] (1 family)
   superhelix turns are made of two very long strands each

5. Family b.80.6.1: Stabilizer of iron transporter SufD [101961] (1 protein)
   this is a repeat family; one repeat unit is 1vh4 A:307-339 found in domain

6. Protein Stabilizer of iron transporter SufD [101962] (1 species)

7. Species Escherichia coli [TaxId:562] [101963] (2 PDB entries)

8. Domain d2zu0b_: 2zu0 B: [171524]
   automated match to d1vh4b_
   complexed with mes

Details for d2zu0b_

PDB Entry: 2zu0, 2.2 Å

PDB Description: Crystal structure of SufC-SufD complex involved in the iron-sulfur cluster biosynthesis

PDB Compounds: (B:) Protein sufD

SCOPe Domain Sequences for d2zu0b_:

Sequence; same for both SEQRES and ATOM records:

>d2zu0b_ b.80.6.1 (B:) Stabilizer of iron transporter SufD {Escherichia coli [TaxId: 562]}
nalqqwhhlfeaegtkrspqaqqhlqqllrtglptrkhenwkytpleglinsqfvsiage
ispqqrdalaltldsvrlvfvdgryvpalsdategsgyevsinddrqglpdaiqaevflh
lteslaqsvthiavkrgqrpakplllmhitqgvageevntahyrhhldlaegaeatvieh
fvslndarhftgarftinvaanahlqhiklafenplshhfahndlllaedatafshsfll
ggavlrhntstqlngenstlrinslampvknevcdtrtwlehnkgfcnsrqlhktivsdk
gravfnglinvaqhaiktdgqmtnnnllmgklaevdtkpqleiyaddvkcshgatvgrid
deqifylrsrginqqdaqqmiiyafaaeltealrdeglkqqvlarigqrlpgga

Timeline for d2zu0b_:

• d2zu0b_ is new in SCOPe 2.01-stable
  
• d2zu0b_ appears in SCOPe 2.02
  
• d2zu0b_ appears in the current release, SCOPe 2.08