Class b: All beta proteins [48724] (176 folds) |
Fold b.80: Single-stranded right-handed beta-helix [51125] (8 superfamilies) superhelix turns are made of parallel beta-strands and (short) turns |
Superfamily b.80.6: Stabilizer of iron transporter SufD [101960] (1 family) superhelix turns are made of two very long strands each |
Family b.80.6.1: Stabilizer of iron transporter SufD [101961] (1 protein) this is a repeat family; one repeat unit is 1vh4 A:307-339 found in domain |
Protein Stabilizer of iron transporter SufD [101962] (1 species) |
Species Escherichia coli [TaxId:562] [101963] (2 PDB entries) |
Domain d2zu0a_: 2zu0 A: [171523] Other proteins in same PDB: d2zu0c_ automated match to d1vh4b_ complexed with mes |
PDB Entry: 2zu0 (more details), 2.2 Å
SCOPe Domain Sequences for d2zu0a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2zu0a_ b.80.6.1 (A:) Stabilizer of iron transporter SufD {Escherichia coli [TaxId: 562]} snalqqwhhlfeaegtkrspqaqqhlqqllrtglptrkhenwkytpleglinsqfvsiag eispqqrdalaltldsvrlvfvdgryvpalsdategsgyevsinddrqglpdaiqaevfl hlteslaqsvthiavkrgqrpakplllmhitqgvageevntahyrhhldlaegaeatvie hfvslndarhftgarftinvaanahlqhiklafenplshhfahndlllaedatafshsfl lggavlrhntstqlngenstlrinslampvknevcdtrtwlehnkgfcnsrqlhktivsd kgravfnglinvaqhaiktdgqmtnnnllmgklaevdtkpqleiyaddvkcshgatvgri ddeqifylrsrginqqdaqqmiiyafaaeltealrdeglkqqvlarigqrlpggar
Timeline for d2zu0a_: