Lineage for d2zu0a_ (2zu0 A:)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1557553Fold b.80: Single-stranded right-handed beta-helix [51125] (8 superfamilies)
    superhelix turns are made of parallel beta-strands and (short) turns
  4. 1557794Superfamily b.80.6: Stabilizer of iron transporter SufD [101960] (1 family) (S)
    superhelix turns are made of two very long strands each
  5. 1557795Family b.80.6.1: Stabilizer of iron transporter SufD [101961] (1 protein)
    this is a repeat family; one repeat unit is 1vh4 A:307-339 found in domain
  6. 1557796Protein Stabilizer of iron transporter SufD [101962] (1 species)
  7. 1557797Species Escherichia coli [TaxId:562] [101963] (2 PDB entries)
  8. 1557800Domain d2zu0a_: 2zu0 A: [171523]
    Other proteins in same PDB: d2zu0c_
    automated match to d1vh4b_
    complexed with mes

Details for d2zu0a_

PDB Entry: 2zu0 (more details), 2.2 Å

PDB Description: Crystal structure of SufC-SufD complex involved in the iron-sulfur cluster biosynthesis
PDB Compounds: (A:) Protein sufD

SCOPe Domain Sequences for d2zu0a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2zu0a_ b.80.6.1 (A:) Stabilizer of iron transporter SufD {Escherichia coli [TaxId: 562]}
snalqqwhhlfeaegtkrspqaqqhlqqllrtglptrkhenwkytpleglinsqfvsiag
eispqqrdalaltldsvrlvfvdgryvpalsdategsgyevsinddrqglpdaiqaevfl
hlteslaqsvthiavkrgqrpakplllmhitqgvageevntahyrhhldlaegaeatvie
hfvslndarhftgarftinvaanahlqhiklafenplshhfahndlllaedatafshsfl
lggavlrhntstqlngenstlrinslampvknevcdtrtwlehnkgfcnsrqlhktivsd
kgravfnglinvaqhaiktdgqmtnnnllmgklaevdtkpqleiyaddvkcshgatvgri
ddeqifylrsrginqqdaqqmiiyafaaeltealrdeglkqqvlarigqrlpggar

SCOPe Domain Coordinates for d2zu0a_:

Click to download the PDB-style file with coordinates for d2zu0a_.
(The format of our PDB-style files is described here.)

Timeline for d2zu0a_: