Lineage for d2bcba_ (2bcb A:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2710066Fold a.39: EF Hand-like [47472] (4 superfamilies)
    core: 4 helices; array of 2 hairpins, opened
  4. 2710067Superfamily a.39.1: EF-hand [47473] (12 families) (S)
    Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop
  5. 2710068Family a.39.1.1: Calbindin D9K [47474] (2 proteins)
    made of two EF-hands only
  6. 2710069Protein Calbindin D9K [47475] (2 species)
  7. 2710070Species Cow (Bos taurus) [TaxId:9913] [47476] (20 PDB entries)
    Uniprot P02633
  8. 2710086Domain d2bcba_: 2bcb A: [17150]

Details for d2bcba_

PDB Entry: 2bcb (more details)

PDB Description: high-resolution solution structure of calcium-loaded calbindin d9k
PDB Compounds: (A:) calbindin d9k

SCOPe Domain Sequences for d2bcba_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2bcba_ a.39.1.1 (A:) Calbindin D9K {Cow (Bos taurus) [TaxId: 9913]}
kspeelkgifekyaakegdpnqlskeelklllqtefpsllkggstldelfeeldkngdge
vsfeefqvlvkkisq

SCOPe Domain Coordinates for d2bcba_:

Click to download the PDB-style file with coordinates for d2bcba_.
(The format of our PDB-style files is described here.)

Timeline for d2bcba_: