Lineage for d2zsvb_ (2zsv B:)

  1. Root: SCOPe 2.02
  2. 1103260Class b: All beta proteins [48724] (174 folds)
  3. 1103261Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1103262Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1105902Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 1105903Protein beta2-microglobulin [88600] (5 species)
  7. 1106406Species Mouse (Mus musculus) [TaxId:10090] [88603] (150 PDB entries)
    Uniprot P01887
  8. 1106424Domain d2zsvb_: 2zsv B: [171487]
    automated match to d1biib_
    complexed with cys, gol

Details for d2zsvb_

PDB Entry: 2zsv (more details), 1.8 Å

PDB Description: Crystal structure of H-2Kb in complex with JHMV epitope S598
PDB Compounds: (B:) Beta-2-microglobulin

SCOPe Domain Sequences for d2zsvb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2zsvb_ b.1.1.2 (B:) beta2-microglobulin {Mouse (Mus musculus) [TaxId: 10090]}
iqktpqiqvysrhppengkpnilncyvtqfhpphieiqmlkngkkipkvemsdmsfskdw
sfyilahteftptetdtyacrvkhdsmaepktvywdrdm

SCOPe Domain Coordinates for d2zsvb_:

Click to download the PDB-style file with coordinates for d2zsvb_.
(The format of our PDB-style files is described here.)

Timeline for d2zsvb_: