SCOPe 2.05: Domain d1cdna_: 1cdn A:

Lineage for d1cdna_ (1cdn A:)

1. Root: SCOPe 2.05

2. Class a: All alpha proteins [46456] (286 folds)

3. Fold a.39: EF Hand-like [47472] (4 superfamilies)
   core: 4 helices; array of 2 hairpins, opened

4. Superfamily a.39.1: EF-hand [47473] (12 families)
   Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop

5. Family a.39.1.1: Calbindin D9K [47474] (1 protein)
   made of two EF-hands only

6. Protein Calbindin D9K [47475] (2 species)

7. Species Cow (Bos taurus) [TaxId:9913] [47476] (18 PDB entries)
   Uniprot P02633

8. Domain d1cdna_: 1cdn A: [17148]

Details for d1cdna_

PDB Entry: 1cdn

PDB Description: solution structure of (cd2+)1-calbindin d9k reveals details of the stepwise structural changes along the apo--> (ca2+)ii1--> (ca2+)i,ii2 binding pathway

PDB Compounds: (A:) calbindin d9k

SCOPe Domain Sequences for d1cdna_:

Sequence; same for both SEQRES and ATOM records:

>d1cdna_ a.39.1.1 (A:) Calbindin D9K {Cow (Bos taurus) [TaxId: 9913]}
kspeelkgifekyaakegdpnqlskeelklllqtefpsllkggstldelfeeldkngdge
vsfeefqvlvkkisq

Timeline for d1cdna_:

• d1cdna_ first appeared (with stable ids) in SCOP 1.55, called d1cdn__
  
• d1cdna_ appears in SCOPe 2.04
  
• d1cdna_ appears in SCOPe 2.06
  
• d1cdna_ appears in the current release, SCOPe 2.08