Lineage for d1cdn__ (1cdn -)
- Root: SCOP 1.61
Class a: All alpha proteins [46456] (151 folds) 
Fold a.39: EF Hand-like [47472] (4 superfamilies) Superfamily a.39.1: EF-hand [47473] (8 families) 
Family a.39.1.1: Calbindin D9K [47474] (1 protein) Protein Calbindin D9K [47475] (2 species) Species Cow (Bos taurus) [TaxId:9913] [47476] (16 PDB entries) 
Domain d1cdn__: 1cdn - [17148]
Details for d1cdn__
PDB Entry: 1cdn (more details)
PDB Description: solution structure of (cd2+)1-calbindin d9k reveals details of the stepwise structural changes along the apo--> (ca2+)ii1--> (ca2+)i,ii2 binding pathway
SCOP Domain Sequences for d1cdn__:
Sequence; same for both SEQRES and ATOM records: (download)
>d1cdn__ a.39.1.1 (-) Calbindin D9K {Cow (Bos taurus)}
kspeelkgifekyaakegdpnqlskeelklllqtefpsllkggstldelfeeldkngdge
vsfeefqvlvkkisq
SCOP Domain Coordinates for d1cdn__:
Click to download the PDB-style file with coordinates for d1cdn__.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1cdn__:
- d1cdn__ first appeared (with stable ids) in SCOP 1.55
- d1cdn__ appears in SCOP 1.59
- d1cdn__ appears in SCOP 1.63
- d1cdn__ appears in the current release, SCOPe 2.08, called d1cdna_
View in 3D