SCOPe 2.04: Domain d2zsqa_: 2zsq A:

Lineage for d2zsqa_ (2zsq A:)

1. Root: SCOPe 2.04

2. Class a: All alpha proteins [46456] (285 folds)

3. Fold a.1: Globin-like [46457] (2 superfamilies)
   core: 6 helices; folded leaf, partly opened

4. Superfamily a.1.1: Globin-like [46458] (5 families)

5. Family a.1.1.2: Globins [46463] (27 proteins)
   Heme-binding protein

6. Protein Myoglobin [46469] (9 species)

7. Species Sperm whale (Physeter catodon) [TaxId:9755] [46470] (239 PDB entries)
   Uniprot P02185

8. Domain d2zsqa_: 2zsq A: [171477]
   automated match to d104ma_
   complexed with cmo, hem, so4

Details for d2zsqa_

PDB Entry: 2zsq, 1.21 Å

PDB Description: carbonmonoxy sperm whale myoglobin at 140 k: laser on [150 min]

PDB Compounds: (A:) Myoglobin

SCOPe Domain Sequences for d2zsqa_:

Sequence; same for both SEQRES and ATOM records:

>d2zsqa_ a.1.1.2 (A:) Myoglobin {Sperm whale (Physeter catodon) [TaxId: 9755]}
vlsegewqlvlhvwakveadvaghgqdilirlfkshpetlekfdrfkhlkteaemkased
lkkhgvtvltalgailkkkghheaelkplaqshatkhkipikylefiseaiihvlhsrhp
gdfgadaqgamnkalelfrkdiaakykelgyqg

Timeline for d2zsqa_:

• d2zsqa_ first appeared in SCOPe 2.01
  
• d2zsqa_ appears in SCOPe 2.03
  
• d2zsqa_ appears in SCOPe 2.05
  
• d2zsqa_ appears in the current release, SCOPe 2.08