Lineage for d2zsmb_ (2zsm B:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2130990Fold c.67: PLP-dependent transferase-like [53382] (3 superfamilies)
    main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest
  4. 2130991Superfamily c.67.1: PLP-dependent transferases [53383] (10 families) (S)
  5. 2132229Family c.67.1.0: automated matches [191328] (1 protein)
    not a true family
  6. 2132230Protein automated matches [190151] (121 species)
    not a true protein
  7. 2132252Species Aeropyrum pernix [TaxId:56636] [188642] (2 PDB entries)
  8. 2132255Domain d2zsmb_: 2zsm B: [171472]
    Other proteins in same PDB: d2zsma2
    automated match to d2gsaa_
    complexed with cl, pmp

Details for d2zsmb_

PDB Entry: 2zsm (more details), 2.3 Å

PDB Description: Crystal structure of glutamate-1-semialdehyde 2,1-aminomutase from Aeropyrum pernix, hexagonal form
PDB Compounds: (B:) Glutamate-1-semialdehyde 2,1-aminomutase

SCOPe Domain Sequences for d2zsmb_:

Sequence, based on SEQRES records: (download)

>d2zsmb_ c.67.1.0 (B:) automated matches {Aeropyrum pernix [TaxId: 56636]}
eksrmlfertkelfpggvnspvraavkpypfyvkrgegaylytvdgarivdlvlaygpli
lghkhprvleaveealargwlygapgeaevllaekilgyvkrggmirfvnsgteatmtai
rlargytgrdlilkfdgcyhgshdavlvaagsaaahygvptsagvpeavarltlvtpynd
vealervfaeygdriagvivepvianagvipprreflaalqrlsresgallildevvtgf
rlglegaqgyfniegdiivlgkiigggfpvgavagsrevmslltpqgkvfnagtfnahpi
tmaaglatlkaleeepvysvsreaakaleeaasevldrtglpytinrvesmmqlfigvee
vsnaaqarkadkkfyvklheemlrrgvfiapsnleavftglphqgealeiaveglrsslk
tvlgs

Sequence, based on observed residues (ATOM records): (download)

>d2zsmb_ c.67.1.0 (B:) automated matches {Aeropyrum pernix [TaxId: 56636]}
eksrmlfertkelfpggvnspvraavkpypfyvkrgegaylytvdgarivdlvlaygpli
lghkhprvleaveealargwlygapgeaevllaekilgyvkrggmirfvnsgteatmtai
rlargytgrdlilkfdgcyhgshdavlvaaggvptsagvpeavarltlvtpyndvealer
vfaeygdriagvivepvianagvipprreflaalqrlsresgallildevvtgfrlgleg
aqgyfniegdiivlgkiigggfpvgavagsrevmslltpqgkvfnagtfnahpitmaagl
atlkaleeepvysvsreaakaleeaasevldrtglpytinrvesmmqlfigveevsnaaq
arkadkkfyvklheemlrrgvfiapsnleavftglphqgealeiaveglrsslktvlgs

SCOPe Domain Coordinates for d2zsmb_:

Click to download the PDB-style file with coordinates for d2zsmb_.
(The format of our PDB-style files is described here.)

Timeline for d2zsmb_: