Lineage for d2zsma1 (2zsm A:7-434)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2130990Fold c.67: PLP-dependent transferase-like [53382] (3 superfamilies)
    main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest
  4. 2130991Superfamily c.67.1: PLP-dependent transferases [53383] (10 families) (S)
  5. 2132229Family c.67.1.0: automated matches [191328] (1 protein)
    not a true family
  6. 2132230Protein automated matches [190151] (121 species)
    not a true protein
  7. 2132252Species Aeropyrum pernix [TaxId:56636] [188642] (2 PDB entries)
  8. 2132254Domain d2zsma1: 2zsm A:7-434 [171471]
    Other proteins in same PDB: d2zsma2
    automated match to d2gsaa_
    complexed with cl, pmp

Details for d2zsma1

PDB Entry: 2zsm (more details), 2.3 Å

PDB Description: Crystal structure of glutamate-1-semialdehyde 2,1-aminomutase from Aeropyrum pernix, hexagonal form
PDB Compounds: (A:) Glutamate-1-semialdehyde 2,1-aminomutase

SCOPe Domain Sequences for d2zsma1:

Sequence, based on SEQRES records: (download)

>d2zsma1 c.67.1.0 (A:7-434) automated matches {Aeropyrum pernix [TaxId: 56636]}
asgeksrmlfertkelfpggvnspvraavkpypfyvkrgegaylytvdgarivdlvlayg
plilghkhprvleaveealargwlygapgeaevllaekilgyvkrggmirfvnsgteatm
tairlargytgrdlilkfdgcyhgshdavlvaagsaaahygvptsagvpeavarltlvtp
yndvealervfaeygdriagvivepvianagvipprreflaalqrlsresgallildevv
tgfrlglegaqgyfniegdiivlgkiigggfpvgavagsrevmslltpqgkvfnagtfna
hpitmaaglatlkaleeepvysvsreaakaleeaasevldrtglpytinrvesmmqlfig
veevsnaaqarkadkkfyvklheemlrrgvfiapsnleavftglphqgealeiaveglrs
slktvlgs

Sequence, based on observed residues (ATOM records): (download)

>d2zsma1 c.67.1.0 (A:7-434) automated matches {Aeropyrum pernix [TaxId: 56636]}
asgeksrmlfertkelfpggvnspvraavkpypfyvkrgegaylytvdgarivdlvlayg
plilghkhprvleaveealargwlygapgeaevllaekilgyvkrggmirfvnsgteatm
tairlargytgrdlilkfdgcyhgshdavlvaaggvptsagvpeavarltlvtpyndvea
lervfaeygdriagvivepvianagvipprreflaalqrlsresgallildevvtgfrlg
legaqgyfniegdiivlgkiigggfpvgavagsrevmslltpqgkvfnagtfnahpitma
aglatlkaleeepvysvsreaakaleeaasevldrtglpytinrvesmmqlfigveevsn
aaqarkadkkfyvklheemlrrgvfiapsnleavftglphqgealeiaveglrsslktvl
gs

SCOPe Domain Coordinates for d2zsma1:

Click to download the PDB-style file with coordinates for d2zsma1.
(The format of our PDB-style files is described here.)

Timeline for d2zsma1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2zsma2