![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.79: Tryptophan synthase beta subunit-like PLP-dependent enzymes [53685] (1 superfamily) consists of two similar domains related by pseudo dyad; duplication core: 3 layers, a/b/a; parallel beta-sheet of 4 strands, order 3214 |
![]() | Superfamily c.79.1: Tryptophan synthase beta subunit-like PLP-dependent enzymes [53686] (2 families) ![]() |
![]() | Family c.79.1.0: automated matches [191338] (1 protein) not a true family |
![]() | Protein automated matches [190215] (38 species) not a true protein |
![]() | Species Aquifex aeolicus [TaxId:63363] [188641] (1 PDB entry) |
![]() | Domain d2zsja_: 2zsj A: [171466] automated match to d1uima_ complexed with plp |
PDB Entry: 2zsj (more details), 1.8 Å
SCOPe Domain Sequences for d2zsja_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2zsja_ c.79.1.0 (A:) automated matches {Aquifex aeolicus [TaxId: 63363]} rwqgiikqykkylpvdentpivtlyegntplieadnlaraigfkgkiylkyeglnptgsf kdrgmtlaiskaveagkravicastgntsasaaayaaraglrayvllpkgavaigklsqa miygakvlaiqgtfddalnivrkigenfpveivnsvnpyriegqktaafeicdtlgeapd yhfipvgnagnitaywkgfkiyyeegkitklprmmgwqaegaapivkgypiknpqtiata ikignpyswksalkaaqesggkidavsdseilyaykliastegvfcepasaasvaglikl vregffkggevvtctltgnglkdpdtaikvceepitvppdfdevvkvlgf
Timeline for d2zsja_: