SCOPe 2.06: Domain d2zscb_: 2zsc B:

Lineage for d2zscb_ (2zsc B:)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.61: Streptavidin-like [50875] (8 superfamilies)
   barrel, closed; n=8, S=10; meander

4. Superfamily b.61.1: Avidin/streptavidin [50876] (2 families)

5. Family b.61.1.0: automated matches [191402] (1 protein)
   not a true family

6. Protein automated matches [190537] (8 species)
   not a true protein

7. Species Pleurotus cornucopiae [TaxId:5321] [188786] (1 PDB entry)

8. Domain d2zscb_: 2zsc B: [171462]
   automated match to d1hy2a_
   complexed with btn, gol, mg

Details for d2zscb_

PDB Entry: 2zsc, 1.3 Å

PDB Description: Tamavidin2, Novel Avidin-like Biotin-Binding Proteins from an Edible Mushroom

PDB Compounds: (B:) Tamavidin2

SCOPe Domain Sequences for d2zscb_:

Sequence; same for both SEQRES and ATOM records:

>d2zscb_ b.61.1.0 (B:) automated matches {Pleurotus cornucopiae [TaxId: 5321]}
sdvqssltgtwynelnskmeltankdgtltgkylskvgdvyvpyplsgrynlqppagqgv
algwavswenskihsattwsgqffsesspviltqwllssstargdvwestlvgndsftkt
apt

Timeline for d2zscb_:

• d2zscb_ first appeared in SCOPe 2.01
  
• d2zscb_ appears in SCOPe 2.05
  
• d2zscb_ appears in SCOPe 2.07
  
• d2zscb_ appears in the current release, SCOPe 2.08