SCOPe 2.05: Domain d2zs8a_: 2zs8 A:

Lineage for d2zs8a_ (2zs8 A:)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (25 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.0: automated matches [191323] (1 protein)
   not a true family

6. Protein automated matches [190123] (96 species)
   not a true protein

7. Species Mycobacterium tuberculosis [TaxId:1773] [189039] (15 PDB entries)

8. Domain d2zs8a_: 2zs8 A: [171457]
   automated match to d1esma_
   complexed with adp, gol

Details for d2zs8a_

PDB Entry: 2zs8, 2.8 Å

PDB Description: Pantothenate kinase from Mycobacterium tuberculosis (MtPanK) co-crystallized with ADP

PDB Compounds: (A:) pantothenate kinase

SCOPe Domain Sequences for d2zs8a_:

Sequence; same for both SEQRES and ATOM records:

>d2zs8a_ c.37.1.0 (A:) automated matches {Mycobacterium tuberculosis [TaxId: 1773]}
epspyvefdrrqwralrmstplalteeelvglrglgeqidlleveevylplarlihlqva
arqrlfaataeflgepqqnpdrpvpfiigvagsvavgksttarvlqallarwdhhprvdl
vttdgflypnaelqrrnlmhrkgfpesynrralmrfvtsvksgsdyacapvyshlhydii
pgaeqvvrhpdilileglnvlqtgptlmvsdlfdfslyvdariedieqwyvsrflamrtt
afadpeshfhhyaafsdsqavvaareiwrtinrpnlvenilptrpratlvlrkdadhsin
rlrlrkl

Timeline for d2zs8a_:

• d2zs8a_ first appeared in SCOPe 2.01
  
• d2zs8a_ appears in SCOPe 2.04
  
• d2zs8a_ appears in SCOPe 2.06
  
• d2zs8a_ appears in the current release, SCOPe 2.08