Lineage for d2zs1c_ (2zs1 C:)

  1. Root: SCOPe 2.02
  2. 1074916Class a: All alpha proteins [46456] (284 folds)
  3. 1074917Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. 1074918Superfamily a.1.1: Globin-like [46458] (5 families) (S)
  5. 1077287Family a.1.1.0: automated matches [191420] (1 protein)
    not a true family
  6. 1077288Protein automated matches [190590] (12 species)
    not a true protein
  7. 1077319Species Oligobrachia mashikoi [TaxId:55676] [187601] (4 PDB entries)
  8. 1077326Domain d2zs1c_: 2zs1 C: [171454]
    automated match to d1x9fa_
    complexed with cl, gol, hem, mg, oxy

Details for d2zs1c_

PDB Entry: 2zs1 (more details), 1.7 Å

PDB Description: structural basis for the heterotropic and homotropic interactions of invertebrate giant hemoglobin
PDB Compounds: (C:) Extracellular giant hemoglobin major globin subunit B2

SCOPe Domain Sequences for d2zs1c_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2zs1c_ a.1.1.0 (C:) automated matches {Oligobrachia mashikoi [TaxId: 55676]}
ssccssedranvmhnwdaawsaaysdrrvalaqavfaslfsrdaaaqglfsgvsadnpds
adfrahcvrvvngldvainmlndpavlneqlahlsaqhqaragvaaahfdvmaeafaevm
pqvsscfssdswnrcfariangisagl

SCOPe Domain Coordinates for d2zs1c_:

Click to download the PDB-style file with coordinates for d2zs1c_.
(The format of our PDB-style files is described here.)

Timeline for d2zs1c_: