SCOPe 2.01: Domain d2zs1b_: 2zs1 B:

Lineage for d2zs1b_ (2zs1 B:)

1. Root: SCOPe 2.01

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.1: Globin-like [46457] (2 superfamilies)
   core: 6 helices; folded leaf, partly opened

4. Superfamily a.1.1: Globin-like [46458] (5 families)

5. Family a.1.1.0: automated matches [191420] (1 protein)
   not a true family

6. Protein automated matches [190590] (10 species)
   not a true protein

7. Species Oligobrachia mashikoi [TaxId:55676] [187601] (4 PDB entries)

8. Domain d2zs1b_: 2zs1 B: [171453]
   automated match to d1x9fb_
   complexed with cl, gol, hem, mg, oxy

Details for d2zs1b_

PDB Entry: 2zs1, 1.7 Å

PDB Description: structural basis for the heterotropic and homotropic interactions of invertebrate giant hemoglobin

PDB Compounds: (B:) Extracellular giant hemoglobin major globin subunit A2

SCOPe Domain Sequences for d2zs1b_:

Sequence; same for both SEQRES and ATOM records:

>d2zs1b_ a.1.1.0 (B:) automated matches {Oligobrachia mashikoi [TaxId: 55676]}
dctslnrllvkrqwaeaygegtnrellgnriwedlfanmpdarglfsrvngndidssefq
ahslrvlggldmcvaslddvpvlnallarlnsqhdsrgipaagypafvasaisavratvg
arsfdndawnscmnqivsgisg

Timeline for d2zs1b_:

• d2zs1b_ is new in SCOPe 2.01-stable
  
• d2zs1b_ appears in SCOPe 2.02
  
• d2zs1b_ appears in the current release, SCOPe 2.08