![]() | Class a: All alpha proteins [46456] (284 folds) |
![]() | Fold a.1: Globin-like [46457] (2 superfamilies) core: 6 helices; folded leaf, partly opened |
![]() | Superfamily a.1.1: Globin-like [46458] (5 families) ![]() |
![]() | Family a.1.1.0: automated matches [191420] (1 protein) not a true family |
![]() | Protein automated matches [190590] (10 species) not a true protein |
![]() | Species Oligobrachia mashikoi [TaxId:55676] [187601] (4 PDB entries) |
![]() | Domain d2zs1b_: 2zs1 B: [171453] automated match to d1x9fb_ complexed with cl, gol, hem, mg, oxy |
PDB Entry: 2zs1 (more details), 1.7 Å
SCOPe Domain Sequences for d2zs1b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2zs1b_ a.1.1.0 (B:) automated matches {Oligobrachia mashikoi [TaxId: 55676]} dctslnrllvkrqwaeaygegtnrellgnriwedlfanmpdarglfsrvngndidssefq ahslrvlggldmcvaslddvpvlnallarlnsqhdsrgipaagypafvasaisavratvg arsfdndawnscmnqivsgisg
Timeline for d2zs1b_: