Lineage for d2zs0d_ (2zs0 D:)

  1. Root: SCOPe 2.05
  2. 1715731Class a: All alpha proteins [46456] (286 folds)
  3. 1715732Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. 1715733Superfamily a.1.1: Globin-like [46458] (5 families) (S)
  5. 1718504Family a.1.1.0: automated matches [191420] (1 protein)
    not a true family
  6. 1718505Protein automated matches [190590] (18 species)
    not a true protein
  7. 1718596Species Oligobrachia mashikoi [TaxId:55676] [187601] (4 PDB entries)
  8. 1718600Domain d2zs0d_: 2zs0 D: [171451]
    automated match to d1x9fa_
    complexed with ca, cl, gol, hem, oxy

Details for d2zs0d_

PDB Entry: 2zs0 (more details), 1.6 Å

PDB Description: Structural Basis for the Heterotropic and Homotropic Interactions of Invertebrate Giant Hemoglobin
PDB Compounds: (D:) Extracellular giant hemoglobin major globin subunit B1

SCOPe Domain Sequences for d2zs0d_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2zs0d_ a.1.1.0 (D:) automated matches {Oligobrachia mashikoi [TaxId: 55676]}
eccsrgdaevvisewdqvfnaamagssesaigvaifdvfftssgvspsmfpgggdsssae
flaqvsrvisgadiainsltnratcdsllshlnaqhkaisgvtgaavthlseaissvvaq
vlpsahidawgycmayiaagigagl

SCOPe Domain Coordinates for d2zs0d_:

Click to download the PDB-style file with coordinates for d2zs0d_.
(The format of our PDB-style files is described here.)

Timeline for d2zs0d_: