SCOPe 2.05: Domain d2zs0c_: 2zs0 C:

Lineage for d2zs0c_ (2zs0 C:)

1. Root: SCOPe 2.05

2. Class a: All alpha proteins [46456] (286 folds)

3. Fold a.1: Globin-like [46457] (2 superfamilies)
   core: 6 helices; folded leaf, partly opened

4. Superfamily a.1.1: Globin-like [46458] (5 families)

5. Family a.1.1.0: automated matches [191420] (1 protein)
   not a true family

6. Protein automated matches [190590] (18 species)
   not a true protein

7. Species Oligobrachia mashikoi [TaxId:55676] [187601] (4 PDB entries)

8. Domain d2zs0c_: 2zs0 C: [171450]
   automated match to d1x9fa_
   complexed with ca, cl, gol, hem, oxy

Details for d2zs0c_

PDB Entry: 2zs0, 1.6 Å

PDB Description: Structural Basis for the Heterotropic and Homotropic Interactions of Invertebrate Giant Hemoglobin

PDB Compounds: (C:) Extracellular giant hemoglobin major globin subunit B2

SCOPe Domain Sequences for d2zs0c_:

Sequence; same for both SEQRES and ATOM records:

>d2zs0c_ a.1.1.0 (C:) automated matches {Oligobrachia mashikoi [TaxId: 55676]}
ssccssedranvmhnwdaawsaaysdrrvalaqavfaslfsrdaaaqglfsgvsadnpds
adfrahcvrvvngldvainmlndpavlneqlahlsaqhqaragvaaahfdvmaeafaevm
pqvsscfssdswnrcfariangisagl

Timeline for d2zs0c_:

• d2zs0c_ first appeared in SCOPe 2.01
  
• d2zs0c_ appears in SCOPe 2.04
  
• d2zs0c_ appears in SCOPe 2.06
  
• d2zs0c_ appears in the current release, SCOPe 2.08